PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn077281
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 430aa    MW: 48729.8 Da    PI: 5.118
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn077281genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.4e-16193238148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +T eE+e ++++++ lG++ W++Ia+ ++ gRt++++k+ w+++l
       Achn077281 193 RGHFTLEEEETIIKLHQSLGNR-WSKIASSLP-GRTDNEIKNVWNTHL 238
                      899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF542362.07E-35695IPR029071Ubiquitin-related domain
Gene3DG3DSA:3.10.20.908.8E-502098No hitNo description
SMARTSM002133.0E-352091IPR000626Ubiquitin domain
PROSITE profilePS5005330.4522095IPR000626Ubiquitin domain
CDDcd018037.06E-502095No hitNo description
PfamPF002402.5E-332293IPR000626Ubiquitin domain
PRINTSPR003485.7E-383050IPR019956Ubiquitin
PROSITE patternPS0029904671IPR019954Ubiquitin conserved site
PRINTSPR003485.7E-385171IPR019956Ubiquitin
PRINTSPR003485.7E-387293IPR019956Ubiquitin
SMARTSM002131.2E-2796167IPR000626Ubiquitin domain
PROSITE profilePS5005326.42496171IPR000626Ubiquitin domain
CDDcd018061.77E-4297171No hitNo description
SuperFamilySSF542361.85E-2697171IPR029071Ubiquitin-related domain
PfamPF002405.8E-2798169IPR000626Ubiquitin domain
Gene3DG3DSA:3.10.20.902.6E-3599171No hitNo description
PROSITE patternPS002990122147IPR019954Ubiquitin conserved site
SuperFamilySSF466894.4E-21174242IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-10174200IPR009057Homeodomain-like
PROSITE profilePS500904.054174187IPR017877Myb-like domain
PROSITE profilePS5129424.505188242IPR017930Myb domain
SMARTSM007172.8E-14192240IPR001005SANT/Myb domain
PfamPF002491.2E-14193238IPR001005SANT/Myb domain
CDDcd001678.26E-10196238No hitNo description
Gene3DG3DSA:1.10.10.608.3E-22201239IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MKLLAQPKKT NLTTQVNENM QIFVKTLTGK TITLEVESSD TIDNVKAKIQ DKEGIPPDQQ  60
RLIFAGKQLE DGRTLADYNI QKESTLHLVL RLRGGTMIKV KTLTGKEIEI DIEPTDTIDR  120
IKERVEEKEG IPPVQQRLIY AGKQLGDDKT AKDYNIEGGS VLHLVLALRG GLLRCGKSCR  180
LRWINYLRPD VKRGHFTLEE EETIIKLHQS LGNRWSKIAS SLPGRTDNEI KNVWNTHLKK  240
RALVHKDANY DKVELTKEFS RTSSSFSTSS FINMEVLEKK ENTLTMENGD EPKEAPSSSS  300
MSSHSSSNCS NSNQVDQVIE IPLESDIDFW EMLDNLDPFK SNESQPHDQF EVSKSSNLGE  360
EDDHGEIEYR KWLKYLENEL GLEATSEGDK NPTKDADGQL GFEMTLRPEN DYGKCYFQMW  420
PSSPQSFGI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2zvn_A1e-79111721154UBC protein
2zvn_C1e-79111721154UBC protein
2zvn_E1e-79111721154UBC protein
2zvn_G1e-79111721154UBC protein
2zvo_A1e-79111721154UBC protein
2zvo_G1e-79111721154UBC protein
3axc_A1e-79111721154Ubiquitin
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF6805571e-147KF680557.1 Panax ginseng putative polyubiquitin (UBQ) mRNA, complete cds.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.17e-44myb domain protein 63